PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016472692.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 638aa    MW: 72126.5 Da    PI: 9.5737
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016472692.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.15.7e-12651461198
                     HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       ++  ++p +fa+++ ++  ++  + le +sg++Wev++    ++gr+ l+ GW++F +   +  gDf++F ++ rs f  +v++f+
  XP_016472692.1  65 DLLCTQRIPEDFASRYCKNMLNP--VYLEVPSGEVWEVEV--VHSQGRICLGIGWQDFSDFYSISCGDFLMFGYNARSHF--NVTIFD 146
                     4456679*********5454444..***************..999999**************************999999..999987 PP

2B344.72.4e-14378456587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     + ps+v+k  +l ++  fa+++  ++e++  l+l+ +s  sW+vk+ + +++    ++ +Wk Fv +n+Lk gD++vF+l++ 
  XP_016472692.1 378 MQPSYVSKPYNLHISFLFARKYF-PEECG-NLVLRVPSRGSWTVKYVVGRSK--AEIRFCWKAFVLDNKLKFGDVCVFELIKG 456
                     67999****99***********7.33454.9***************555555..558999*******************9864 PP

3B350.92.7e-16541628595
                     -..-HHHHT...T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   5 ltpsdvlks...grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     + ps+v++     rl++  + a+++     ++ +++l+ +s +sW vk+i   ++    lt+GWk+Fv +n+Lk+gD++vF++++rs+   ++ 
  XP_016472692.1 541 MQPSYVSSAcgpMRLSITLSRARKFFAT--RHSDVVLQVSSKKSWAVKCIL--GPANAKLTSGWKDFVLDNNLKVGDVCVFERVSRSKL--LFN 628
                     4445555557667999999999999755..4558***************55..555566***********************7766555..444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.7E-1721148IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.001256148IPR003340B3 DNA binding domain
SuperFamilySSF1019361.04E-1565148IPR015300DNA-binding pseudobarrel domain
CDDcd100175.86E-1067146No hitNo description
PfamPF023621.6E-868146IPR003340B3 DNA binding domain
PROSITE profilePS5086311.22372148IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.8E-19366457IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.01E-19367457IPR015300DNA-binding pseudobarrel domain
SMARTSM010196.7E-9373464IPR003340B3 DNA binding domain
PROSITE profilePS5086310.588374469IPR003340B3 DNA binding domain
CDDcd100177.38E-16378457No hitNo description
PfamPF023624.4E-12378456IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-22529632IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.16E-20530632IPR015300DNA-binding pseudobarrel domain
CDDcd100171.32E-16535632No hitNo description
SMARTSM010194.7E-10537630IPR003340B3 DNA binding domain
PROSITE profilePS5086312.308540635IPR003340B3 DNA binding domain
PfamPF023622.9E-14540627IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MAAKPQLQRD EGSSHWKSST NITQPKFFKI IFSQHESSRL VYCRIFSRKT GIFYCDSRSM  60
KLSLDLLCTQ RIPEDFASRY CKNMLNPVYL EVPSGEVWEV EVVHSQGRIC LGIGWQDFSD  120
FYSISCGDFL MFGYNARSHF NVTIFDLSAS EIEYPYSSVH GIHTPISYCH ETRHAPKRDQ  180
SGSDDSVEIL EGIPRSQKAK AKIPDTVEHS VENLGQCPLG QSSKRKRQKG DAEHDASVDM  240
HVKRMKVEKL QEDVASPSFI REGQNHGEGT EIEHSLEILD HCPSGHGSKR KGLEGDAEDD  300
VSTDIHTRSI KVEKSRENVA SPSFTRKTKK SGESCRMHKQ QSKLVSAKNK TVLEKKRSIA  360
YQRARAFKSE NPFVIYFMQP SYVSKPYNLH ISFLFARKYF PEECGNLVLR VPSRGSWTVK  420
YVVGRSKAEI RFCWKAFVLD NKLKFGDVCV FELIKGTKPI LDATIFPAAE SKAKHKIDGK  480
LPDVSDCKNK IIKTENSEDA GKHVQQSKSS CKGRVVAKEM VIAYQRAKAF KSENPFFVCF  540
MQPSYVSSAC GPMRLSITLS RARKFFATRH SDVVLQVSSK KSWAVKCILG PANAKLTSGW  600
KDFVLDNNLK VGDVCVFERV SRSKLLFNVI IYTSAEGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1534663618144B3 domain-containing transcription factor VRN
4i1k_B2e-1534663618144B3 domain-containing transcription factor VRN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224245RKRQKGDAEHDASVDMHVKRMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016472692.10.0PREDICTED: B3 domain-containing protein Os11g0197600-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.12e-17related to vernalization1 1